Desulfobacterium autotrophicum HRM2 uid59061

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|224367204|ref|YP_002601367.1| putative peroxiredoxin [Desulfobacterium autotrophicum HRM2]
    MEKSNTMPMLGDTFPEFSAATTHGPMNFPQDLKGQWFVLFSHPADFTPVCTTEFVAFQKRIKAFEDMGVKLIGMSVDQVF
    SHIKWVEWIEEKLDVEITFPIVAANDAIADKLGMLHPGKGANTVRAVFVVDPESRVRLMLYYPQEIGRNMDEIVRAVKAL
    IQSDKDGVAIPAGWPENELIGDKVIIPPAQDQAEAKKRPGQYDCYDWWFCYRDLK

    >gi|224367355|ref|YP_002601518.1| Fe(III) ABC-type transporter, periplasmic substrate-binding protein [Desulfobacterium autotrophicum HRM2]
    MSSTPIPGQGRPVSRRDTLNKDISRIKTALWLSLFMVLSNLAPVLGAQRVVDQNGRTLIFERPFSRIISLYGAHTENLVF
    LGLDREIIGVSRSDIHDPRFSTTPWFSAHDGPEKFLGARPDLILIRPMIERG
    CSRLIQQLERSGITVVSLQPADVEGMYD
    YWTTLGRLTGRNEQAGAMVADFKHQVAGFRALTKGIAPKKQVYFEAIHSKMKTFTPGSMALFALEVAGGINVAKDARASR
    GTNIGNYGKEQILAHADKIDVFLAQQGEMNPVSRETIETEPGFAMIKAVKNNAIYLIDEQIVSRPGFRLLQGIKTIGEIL
    YPDIFGALDPRNSDALIQEKRKAF

    >gi|224367487|ref|YP_002601650.1| hypothetical protein HRM2_03660 [Desulfobacterium autotrophicum HRM2]
    MKKLFIYVFSMVFVLTAAGFAFADDSAMLKANEEKAWENATKVFPVERQLDVQGFKDLYDKVMAGQEDAYLVDLRTHPEF
    YAGHIAGTDHIHAGHMYTFPKIITNKDAKIVVW
    CRTHKRGAYVGERLTQYGYTNVWWYKDGILGWIKAGYPLCNQFMGQF
    KVTGYDKNFTEIDKETQKPLYHIREFHPF

    >gi|224367566|ref|YP_002601729.1| QmoA [Desulfobacterium autotrophicum HRM2]
    MTTDNSAPTSGSIMVVGGGISGLTTALEAAEVGYEVFIVEKEPSLGGRVSQLKQYFPKLCPPTCGLEINYKRIKDNPKIT
    VITMAEVDKVDGKPGDYTVKLKISPRYVNENCTACGECAKVCESEISNEYNLGMDRCKAAYLPHNMAFPQRYVMAPSMAQ
    DDRDRCKEACKFDAIDFDMEEKSLDLKVGAIVWATGWRPYDAARIDNLGFGRYQNIITNMMLERLASPNGPTRGKIIRPS
    DDKAPATIGFVQCAGSRDENHLPYCSYICCMASLKHATYLRAQYPEAKIYIYYIDIRTPGRKYENFYKKLKEDKNIFFVK
    GKVAEVGEEEGTGNITLVAEDTMSGDKVRQTVDLLVLATGMQPNSAVERPNADLTFNSDGFIVNDFKKGGMFAAGCANKP
    ADVVTSNQNATGMALKAIQTLVRR

    >gi|224367736|ref|YP_002601899.1| mercuric reductase (Hg(II) reductase) [Desulfobacterium autotrophicum HRM2]
    MKKPTKTKSLVMTAIAAMVVCFYLFDLKAYVSLDFMRESLNAFQAYYVNHRVATIMAYMAVYIAMAALSLPGAVMLTLLG
    GALFGTLLGTVLVSFASTIGATLAFLVSRFLFREAVQRRFKEKLDAINRGVEQDGGFYLFTLRLVPVFPFFIINLVMGVT
    PISLPLYYGASQIGMLPATFVYVNAGTQLAGLESIQGILSFNLLAAFALLGILPLVAKKVTAMVQARKQLAPYPRPKQFM
    YNLVVIGAGSAGLVSSYIAATVRAKVALVEADKMGGD
    CLNTGCVPSKALIRSAKIMAQAARAQTYGFEKADITFDFSKVM
    ERVHDIIRTVEPHDSVERYTQLGVTCIKGRARVISPWEVEVNGSRLTTRSIVIATGARPMVPDIPGLSTVDYLTSDTVWQ
    LTTLPRRLLVLGGGPIGCELSQAFARLGSTVTLVQRGPRILNREDPEVSELIRQTFKHEGVQVLTDHSAREIIHTDQGSV
    LVCDHGGVDKKIEFDTILIALGRVANTQGMGLKTLGLEMSDTGKIKAGNFMETNFPNIFCAGDVAGPYQFTHVAAHQSWY
    ATVNALFGMFKRFRVDYSVIPWATYTDPEVARVGLNENEAKQRKIDHEVTVYKIEDLDRAITDSEARGFVKVITPPGKDR
    ILGVTIVGSHAGDTIAEFVLAMRHGLGLNKILGTIHIYPTMAEANKYAAGQWKKAHAPEKILAWVRRLHDFLRT

    >gi|224367810|ref|YP_002601973.1| NqrD [Desulfobacterium autotrophicum HRM2]
    MAKEKSNRLDIMVRGIWRENPVAFQVLGICSALAVTVKMSTALVMAVALTVVTACSSFTISLLRKQIPSNIRIIVELAII
    ASLVIITDEVLKAFFYDTSKQLSIFVGLIITN
    CIVLGRAEAFALANTPGDSFVDGIANGIGYGLILVAVAFIRELLGSGN
    IFGIPVIPGFMIEAGYQNMGLMVLAPGAFFIIGLLVWLKNSLPGVSHENK

    >gi|224367811|ref|YP_002601974.1| NqrE [Desulfobacterium autotrophicum HRM2]
    MGDLFSLFINSVFIGNILLAYFLGMCSFIAVSKNIETATGLGFAVIFVLTVTSPVNWVVYHGLLAPGALAWAGLPNVDLS
    FLKYITFIAVIAAIVQALEMVIDKYSPLLYAALGVFLPLIAVN
    CAILGTSLFMVERNYTLVESMVFGAGSGTGWMLAIVS
    MAAIRKKVQYADVPVGLQGFGITMIVAGLMAMTFMMFSGITL

    >gi|224367843|ref|YP_002602006.1| Dihydrolipoyl dehydrogenase (E3 component of pyruvate and 2-oxoglutarate dehydrogenases complexes) [Desulfobacterium autotrophicum HRM2]
    MTREVDVAIIGAGTAGLTAQEFVAEKTDNYVIIDDGPLGTTCARVGCMPSKALIAVANNFHKCLFFDEYGISGANALRPD
    YSRIMAWVRMLRDEFTDGVIQEMSTFTDRLIRKRARFIDANTLDLGDERIRARRIIIATGSKPWIPERWQPYKDLIIDTD
    QFFELADLPGSLAVFGLGPIGIELGQALHRLGVEIIAFSRRKTAGGLTDPDLQTYAFEHFSKEMNIKLGTADIRRRLGNK
    VVVGCESGEWTVDRILLATGRRPVIQDLGLENLGVELDDRGMPPFDPGTLQIKDLPVFLAGDVNGQKPILHEAADDGTIA
    GYNTTAKRISCFKKRTPLAITFSSPDIAIAGLSHKELTTRGVEFVTGKASWEKLGRARMILGKAAGIARIYADKKNGRLL
    GAELMAPAGEHMAHLLSWAVGAGLTAARALTMPFYHPVPEEALRSALGQILKQIDDPAPDFRLELCQKKGDS

    >gi|224367920|ref|YP_002602083.1| FAD/NADH-dependent pyridinepyridine nucleotide-disulphide oxidoreductase [Desulfobacterium autotrophicum HRM2]
    MKNGERLVIIGGGGGGFATAMRAKALMPKIDITLVRKEKRFIVRCSLPYVVSGLVTGESIVNPDKKFIDAGINVIVDEVT
    HVDTKQKKVRLSNAREIPYDKLVMATGATPVVPPIEGSDLDGVFTFRSLSDAEKILDFMEKKKPRKMIFIGAGFITMELA
    SNLLITPSERYEITIVEMLEHPLPLMLDAEFGTKLQEYLTEKGLKMKMGHRVTKILGRDQAVSAVVLENNEQLEADLIVL
    NVGVKANLELAKQIGLETGAYGIKTNEYMETSEPDIFALGDCAEKKHFITGKPVPGVLRGPAIIAGRHVAKKLAGYDVPF
    PGVLDNAVVRLFDKSIGFTGLTETRAREEGYDPVCATVESRSKHMMMPGMKPWTIKLVFDRKSKKLLGGQILSDSEAPVK
    EIDTVNALILGGKTVYDLCSIMCAGQPDLSSEPSAEPISIAAEQVLVKM

    >gi|224367988|ref|YP_002602151.1| MsrAB [Desulfobacterium autotrophicum HRM2]
    MKTRMMMFLMIFTAVFIFGCLSFAEKQETKEVTMKTDTKSHMEKLDVATFAGGCFWCTESDFEQVKGVKDVVSGYTGGHK
    TDPTYSEVSGGTTGHTEAIQVYYDPGMVTYNELLAVFWRHINPTDPGGQFADRGSQYRPEIFYHNDNQKEEAMASKKALE
    ASMVFDKPIATAITKFEKFYPAEDYHQDYYKKNSYRYKYYRWGSGRDAFLEKTWGKKAMEGKTMEIKEKNAMETASWSKP
    SDAEIKEKLTPMQYKVTRENGTERPFNNEYWDNKHQGIYVDIVSGEPLFSSTDKFVSGTGWPSFTKPLESEHVIEVTDKT
    LFMVRTEVRSRYGDSHLGHLFDDGPKPTGLRY
    CINSAALRFIPKENLEAEGYGRYLDLF

    >gi|224368102|ref|YP_002602265.1| pyridine nucleotide-disulphide oxidoreductase [Desulfobacterium autotrophicum HRM2]
    MKSDVVIIGGSAAGLMAALTLKKRAPEKTVTIIRNVINTPIPCGIPYIYGIMGQVNKNLIPDQGFIDQGIEILQREVEDI
    DRADKAVVFSDGDRISYDKLIISTGSKPFVPPLAGIDKTNVFTVKKDPVYLQKVYTALTPARNVVVIGGGFIGVEMAEQI
    ALMGQKAGIEKKVTVLEMMPRCLMLACEEEFCLEIEEELKKVGVMVKTNCQAEELIGNGGIKGVKLANGEIITADAVVIG
    IGAQANIDLAIKCGLEADPRNGIKVDKYMQTDDADIYAAGDCASKFSCITGKPSGIRLASVAASEGMIAASNLCKGRSRV
    TMGALGAFSTKVGNRSVAAAGMTSRSATEEGIEFVVGEVTTPNRHPGHLPGSVSDMKIKLLFRRDNDQVIGGHVSGGDAA
    SDMVNIIATAIQANLTAEQLAVMQYATHPLMTASPLSYHVMLAAENAAVKLR

    >gi|224368127|ref|YP_002602290.1| Glutaredoxin-related protein [Desulfobacterium autotrophicum HRM2]
    MGKGRPMEPDQRIKKELPNGWQNEIKACKGLRLKPYQTIKFKGVPMLKVYAAHWCPHCTKTVDYLKKNNIEFEYIEIEAQ
    PDQTIKKIIEVNGGDDWVIPTLEFNGKWRPGKVYNEFELHFDLKEMGVIGQK

    >gi|224368143|ref|YP_002602306.1| Tpx [Desulfobacterium autotrophicum HRM2]
    MAKFTIGGNPANTSGDLPQVGEKAPEFLLTKTDLTDISLKDVAGKKVVLNIFPSVDTPVCSASVRRFNSEINNYANAVVL
    CVSLDLPFAHSRFCETEGLKNVIPVTELRNRDFGRAYGLRIVDGPLAGLLARGVVVMDEQGTVIFSKLVPELKTEPDYEP
    VLTVLGKRVSAENVCTQTSTAEHSRLNENDEPCDDGRAG

    >gi|224368177|ref|YP_002602340.1| rhodanese-like domain protein [Desulfobacterium autotrophicum HRM2]
    MKWKPYLTPIRSFDPDEARAFLNHRPVDQVTLVDVRQPGEYQAGHIPGARLIPLPELVDRLDDIPRNFPVIVYCSSGPRS
    RAACQLMTLDDSFGEIINLTGGFNAWEGEAALGRENQGLTFFTGAETPREILEIAYGLEQGLREFYLSMDKQVKNPGVRR
    LFATLARVETLHQESILREYQRIIDPSIKEDQLTAAALQGTLEGGMTTQEYIDYYMPQWEDPEDVVFLAMAIEAQALDLY
    LRAKTRVVDETSRKILTRIAQEEKSHLVHLGELMDGLISGTAT

    >gi|224368270|ref|YP_002602433.1| HesB-like domain protein [Desulfobacterium autotrophicum HRM2]
    MIDVTLAAQDQVLAYFEGKESKSVRIFLNNGCGGAQLAMAVDEKTPKDKVFEYKGVEYVMDQKLFDQAKPVLVDYSNNGF
    KLESSLKLSSGCSSCGSKGSCCS

    >gi|224368278|ref|YP_002602441.1| TrxA1 [Desulfobacterium autotrophicum HRM2]
    MAESVIVVCDSCGTKNRIPRDRIDQGPLCGRCKQPLGREQIFTAPVTATDQTFDQEVLAHRGGVIVDFWASWCGHCKTME
    PVLSGLAKAYAGRIKIVKVNVDENASTAARYRIMSLPSLVFFKAGKVVDSTVGALSRGEIETRLKPLL

    >gi|224368284|ref|YP_002602447.1| HdrA1 [Desulfobacterium autotrophicum HRM2]
    MTNKPVGSVLLAGGGISGIQSALDMADSGYYVYLVEKSSGIGGAMAQLDKTFPTNDCAMCIVSPKLVECGRHLNIELLTL
    SEIEKVTGEQGNFTVTIKKKPRYVDEDKCIACGLCAEKCPKKVPDEYNEGLNYRKAAYIKYGQTVPLKYAIDPDNCIMIN
    KGKCGVCAKICPTGAINFEMKPEFVDVNVGAVVLAPGFKPYSPKGVDYYGYDEIPDVITSLEYERYLSASGPTIGHIARP
    SDGGEPNKIAWIQCVGSRNTNCVKNGYCSSVCCMYSIKQAVMTGSHLSSDDNEQTIFYMDMRTVGKEYERYYEASKTQGV
    SYVKARPHTLLAGPDGVGVTMTYTDENGVQHNNEYFDIVVLSIGLEAPQ